Free access
Research Article
15 May 2005

Comparative Genomics of Foot-and-Mouth Disease Virus

ABSTRACT

Here we present complete genome sequences, including a comparative analysis, of 103 isolates of foot-and-mouth disease virus (FMDV) representing all seven serotypes and including the first complete sequences of the SAT1 and SAT3 genomes. The data reveal novel highly conserved genomic regions, indicating functional constraints for variability as well as novel viral genomic motifs with likely biological relevance. Previously undescribed invariant motifs were identified in the 5′ and 3′ untranslated regions (UTR), as was tolerance for insertions/deletions in the 5′ UTR. Fifty-eight percent of the amino acids encoded by FMDV isolates are invariant, suggesting that these residues are critical for virus biology. Novel, conserved sequence motifs with likely functional significance were identified within proteins Lpro, 1B, 1D, and 3C. An analysis of the complete FMDV genomes indicated phylogenetic incongruities between different genomic regions which were suggestive of interserotypic recombination. Additionally, a novel SAT virus lineage containing nonstructural protein-encoding regions distinct from other SAT and Euroasiatic lineages was identified. Insights into viral RNA sequence conservation and variability and genetic diversity in nature will likely impact our understanding of FMDV infections, host range, and transmission.
Foot-and-mouth disease (FMD) is an acute, systemic disease of domestic and wild cloven-hooved animal species and is caused by Foot-and-mouth disease virus (FMDV), the prototype member of the genus Aphthovirus of the family Picornaviridae. FMDV occurs as seven distinct serotypes (Euroasiatic serotypes A, O, C, and Asia1 and South African Territories [SAT] serotypes SAT1, SAT2, and SAT3) and multiple subtypes reflecting significant genetic variability. The highly contagious nature of FMDV and the associated productivity losses make it a primary animal health concern worldwide. Effective vaccines and stringent control measures have enabled FMD eradication in most developed countries, which maintain unvaccinated, seronegative herds in compliance with strict international trade policies. However, the disease remains enzootic in many regions of the world, posing a serious problem for commercial trade with FMD-free countries.
FMDV is a small nonenveloped virus with a pseudo T=3 icosahedral capsid made up of 60 copies each of four structural proteins. The capsid surrounds an 8.4-kilobase, positive-sense, single-stranded RNA genome which is covalently bound at its 5′ end to the small viral protein 3B (or VPg) and is polyadenylated at its 3′ end. Upon virus entry into a cell, the viral genome is rapidly translated into a polyprotein which is co- and posttranslationally cleaved by viral proteinases into several partially cleaved, likely functional, intermediates and ultimately into 12 mature proteins (87, 97).
The FMDV genome organization is similar to that of other picornaviruses, including a large single open reading frame (ORF) flanked by highly structured 5′ and 3′ untranslated regions (5′ UTR and 3′ UTR, respectively) (Fig. 1A). The 5′ UTR consists of, from the 5′ end, a 350- to 380-nucleotide (nt) “short” (S) fragment, a 100- to 420-nt poly(C) tract (90% C), and the approximately 700-nt 5′ terminus of the genomic “long” (L) fragment, which contains three or four tandemly repeated pseudoknots, a stem-loop cis-acting replication element (cre), and a type II internal ribosome entry site (IRES) (69). The FMDV 5′ UTR plays important roles in cap-independent translation initiation of the viral polyprotein and in viral genome replication (64). The 3′ UTR is about 90 nt long and is thought to contain cis-acting elements required for efficient genome replication (4).
The four capsid proteins, 1A, 1B, 1C, and 1D (also known as VP4, VP2, VP3, and VP1, respectively), are encoded by the N-terminal half of the ORF, and with the exception of 1A, which is excluded from the virion surface, are involved in antigenicity and binding to a subset of RGD-dependent integrins and heparan sulfate proteoglycan receptors on the cell surface (reviewed in reference 45). Nonstructural proteins represent about two-thirds of the ORF-encoded proteins and include Lpro, 2A, 2B, 2C, 3A, 3B, 3Cpro, and 3Dpol (93). FMDV polyprotein processing is mediated by Lpro, 3Cpro, and 2A. Lpro is a papain-like protease that, in addition to excising itself from the polyprotein, cleaves the cellular translation initiation factor eIF4G, resulting in a shutoff of host cap-dependent translation (65). 3Cpro, a member of the trypsin family of serine proteinases, performs all but three of the cleavages leading to mature viral proteins and also cleaves host cell proteins (111). FMDV 2A mediates autocleavage at its C terminus, apparently by inducing a ribosomal skip during polyprotein synthesis (19, 20). Although the functions of the FMDV 2B and 2C proteins are unknown, preliminary work suggests that, similar to those of other picornaviruses, they localize to endoplasmic reticulum (ER)-derived vesicles, the sites of viral genome replication (106). 3A is thought to be a multifunctional integral membrane protein that enhances viral RNA synthesis by 3Dpol and stimulates cleavage of the 3CD precursor (91). FMDV encodes three nonidentical copies of genome-linked 3B, a protein required for viral RNA replication (26). The 3D gene encodes the viral RNA-dependent RNA polymerase, and it and 3A colocalize with ER membrane-associated replication complexes (80, 92).
Despite a basic understanding of many aspects of picornaviral biology, much information regarding FMDV UTR, protein, and protein precursor functions and roles in virulence, host range, and virus transmission remains poorly understood. Comparative genomic analysis of a large number of FMDV genomes may allow the identification of highly conserved regulatory or coding regions which are critical for aspects of virus biology. To date, the few comparative analyses of full-length FMDV genomes have relied on intratypic (serotype O) or intertypic (serotypes O, A, and C) comparisons of a small number of isolates and serotypes (70, 86). In addition, complete genomic sequences of some serotypes are not available (SAT1 and SAT3) or, for others, only represent highly cell culture-adapted isolates (serotypes A and C). Studies involving large numbers of virus isolates have largely focused on genomic regions encoding structural proteins associated with serotype specificity for phylogenetic purposes (reviewed in reference 55).
For this work, we obtained and analyzed 103 complete genome sequences representing all FMDV serotypes, including the previously unavailable SAT1 and SAT3 genomes. Our analyses identified novel highly conserved genomic regions indicating functional constraints for variability, novel viral genomic motifs with likely biological relevance, and previously undescribed virus lineages.

MATERIALS AND METHODS

FMDV isolates.

One hundred three FMDV isolates were obtained from the Animal Plant Health Inspection Service, United States Department of Agriculture (Table 1). Except for recent isolates from Argentina, the United Kingdom, and South Korea (2000-2001), most isolates belonged to the Animal Plant Health Inspection Service archive collection and represented a broad temporal and geographical distribution (Table 1). Although certain archive isolates have been adapted to guinea pigs or passaged in cell cultures, isolates obtained from their natural hosts were well represented. For some analyses, complete genome or whole polyprotein FMDV sequences currently available in GenBank release 141 were considered and included (Table 1).

FMDV RNA isolation, RT-PCR amplification, and sequencing.

Full-length FMDV genome sequences were obtained by reverse transcription (RT) of the complete viral genomic RNA followed by redundant amplification and sequencing of overlapping cDNA fragments spanning the entire viral genome. The total RNA was extracted directly from 140 μl of vesicular fluid, the supernatants of infected cell cultures, or 0.1 g of epithelial tissue from vesicular lesions by the use of RNeasy Mini kits (QIAGEN) and was then resuspended in 40 μl of double-distilled H2O.
Complete viral genomes were reverse transcribed to cDNAs by use of a Super SMART PCR cDNA synthesis kit (Clontech), using the supplied modified oligo(dT) according to the manufacturer's instructions. After spin column purification, the full-length double-stranded cDNA from each isolate was amplified in eight identical long-distance PCRs (2 μl cDNA in a 50-μl reaction volume; 20 cycles of 95°C for 15 s, 65°C for 15 s, and 68°C for 2 min) using primers supplied in the kit. Next, 21 overlapping 1.2-kb PCR amplicons spanning the whole FMDV genome were generated in 96-well plates (2.5 μl of template from each of the eight double-stranded cDNA replicates in 25-μl reactions using the primers described in Table S1 in the supplemental material). Adjacent amplicons overlapped for >50% of their lengths. To prevent truncation by subsequent rounds of PCR, we artificially created poly(C) sequences by substituting flanking sequences with specific primers (F1R and F2F) containing six C's or G's.
Amplified products of the correct size were purified (DNA filtration system; Eppendorf) and resuspended in 40 μl of sterile double-distilled H2O per well. All amplicon replicates (eight per FMDV subgenomic fragment per isolate) were subjected to direct sequencing (2.5 μl of template per reaction) using position-specific forward and reverse primers (see Table S2 in the supplemental material), Big Dye Terminator cycle sequencing kits (Applied Biosystems), and a PRISM 3730xl automated DNA sequencer (Applied Biosystems). To overcome virus variability and PCR/sequencing errors, we sequenced each amplicon in multiple reactions with both forward and reverse primers, specifically selected by serotype (see Table S2 in the supplemental material). Since each amplicon overlapped its neighbor >50%, the multiple direct sequencing reactions resulted in a redundancy rate ranging from 13 to 48 and averaged 28 sequence events per nucleotide.
Direct DNA sequencing of amplicons derived from a given FMDV isolate yielded a master sequence representing the most probable nt for each position of the sequence. This approach prevented analyses of minor sequence variants, polymerase misincorporation errors, and sequencing ambiguities through multiple independent cDNA synthesis, PCR amplification, and direct sequencing events. Due to the quasispecies nature of FMDV populations, polymorphisms were detected at some nt positions. Nevertheless, all positions could be unambiguously assigned to a single nt due to the high degree of redundancy generated by the sequencing strategy. The following sequence ambiguity code was used: K (T/G), M (A/C), R (A/G), S (C/G), W (A/T), Y (C/T), B (C/T/G), D (A/T/G), H (A/C/T), V (A/C/G), and N (A/C/G/T).

Sequence analysis.

Bases were called from chromatogram traces produced with Phred (25), which also produced a quality file containing a predicted probability of error at each base position. Viral sequences were assembled with the Phrap (http://www.phrap.org ) and CAP3 assemblers (43). Gap closure was performed as described previously (3). Multiple sequence alignments were performed with the ClustalW (1.7) and Dialign (2.2) computer programs (73, 107). The positions of 5′ UTR sequences presented in Results refer to the consensus sequence generated by ClustalW alignment of this region for the 103 isolates, with some manual editing. Nucleotide substitution analysis was carried out by use of the DISTREE (1.2) (103), DNArates (1.1) (105), ALISTAT (16), and PRETTY (GCG 10 software package [16]) programs. Analyses of codons and synonymous/nonsynonymous (syn/nonsyn) substitution ratios were calculated by using SNAP (77), CodonW (http://www.molbiol.ox.ac.uk/cu/ ), and codeml (PAML3.14 package), which was also used for statistical evaluations of heterogeneous selection pressures at amino acid sites (116). For protein analysis, the PRETTY program was used. Searches for motifs and/or signal sequences were performed with the MOTIFS (GCG package), HMM (58), pfscan (http://www.isrec.isb-sib.ch/ftp-server/pftools/pft2.2/pft2.2.tar.Z ), and Blocks (36) programs of the PROSITE, Pfam, and Blocks databases. Transmembrane protein segment predictions were performed by using Memsat (50), Tmpred (41), Toppred (114), Psort (76), and Saps (11). Secondary structure predictions were performed for proteins by using GOR secondary structure prediction (29) and Pratt (48, 49) and for RNAs by using mfold (46, 117), rnafold (40), and Squiggles (83). Pseudoknot analysis was conducted with pknots (96).
Phylogenetic analysis was performed on aligned genomic and subgenomic regions of FMDV by utilizing the neighbor-joining and split decomposition methods as implemented in the Phylo_win (28) and/or SplitsTree 4.0 (http://www-ab.informatik.uni-tuebingen.de/software/jsplits/welcome_en.html ) (44) software package and by utilizing maximum likelihood as implemented in Puzzle (104) and dnaml in the Phylip package (http://evolution.genetics.washington.edu/phylip.html ) (27). Individual protein-coding regions were used to screen for incongruent tree topologies suggestive of genomic recombination, and split decomposition analysis (7) of genomic and subgenomic regions was utilized to graphically screen for reticulated branching patterns which were also suggestive of recombination. Similarity plots and bootscanning analysis (100), which compare a given query sequence to several reference sequences via incremental sliding sequence windows to yield corrected similarity values and bootstrap resampling frequencies, respectively, were performed as implemented in the SimPlot, v. 2.5, package (63), utilizing default settings and a window size of 400 nt. As a further test for potential recombination, Sawyer's run test (102), as implemented in GENECONV, v. 1.81 (http://www.math.wustl.edu/∼sawyer ), was used on Dialign-aligned FMDV polyprotein-encoding regions, using default settings.

Nucleotide sequence accession numbers.

The GenBank accession numbers for the genome sequences of FMDV isolates sequenced for this study are listed in Table 1.

RESULTS AND DISCUSSION

With the exception of the poly(C) tract, full-length genomic sequences from 103 FMDV isolates representing all serotypes, including isolates from serotypes not previously fully sequenced (SAT1 and SAT3), were obtained and analyzed. Given that the structure and dynamics of FMDV populations in nature are complex and the relatively small number of SAT2 and SAT3 genomes presented here, it is possible that additional sequence data from field isolates will alter the status of residues and nucleotides presented below as invariant.
FMDV genomes ranged from 8,046 to 8,215 nt, consistent with previously reported genome lengths (86, 108). Although small insertions/deletions were observed in the coding region affecting Lpro, 1B, 1C, 1D, and 3A, most variability in genome size was due to insertions/deletions in the UTRs.

5′ UTR.

The approximately 1,300-base 5′ UTR plays important roles in FMDV replication. However, the specific contribution of S fragment, poly(C) tract, and L fragment pseudoknots to FMDV biology is unknown. The cardiovirus poly(C) tract has been shown to affect virulence (23), while shortening of the FMDV poly(C) tract affected virus growth in vitro but not virulence in a suckling mouse model (95). The cre is essential for picornaviral replication and contains a conserved AAACA motif which in poliovirus functions as a template for 3Dpol-mediated uridylylation of 3B (75). Mutation of the FMDV cre stem region reduced virus RNA replication (68). The approximately 500-nt FMDV IRES, which is responsible for cap-independent polyprotein translation (60), is predicted to contain four structural domains (Fig. 1D, panel II, domains 2 to 5) that interact with cellular factors involved in host translation initiation (94). Domain 2 binds the polypyrimidine tract-binding protein at a UUUC motif. Domain 3 contains at least three loop structures that are conserved in all picornaviruses, including a GNRA motif essential for the maintenance of the IRES tertiary structure and potentially involved in long-range RNA-RNA interactions. The Y-shaped domain 4 and domain 5 interact with the host translational factors eIF4B and eIF4G (65, 99). A 22-nt spacer for ribosomal recognition separates the IRES from the first of two polyprotein start codons, and an additional 84 nt separates the first start codon from the second. Picornavirus utilization of the second start codon seems to be affected by its adjacent sequence and by sequences in the IRES (82). Unlike poliovirus, FMDV utilizes the second start codon twice as often as the first (66).
The analysis in this study of 5′ UTRs from 103 FMDV isolates showed that only 12% and 33% of nt were invariant in the 5′ UTR S and L fragments, respectively (Fig. 1B and C; Table 2). In pairwise comparisons, however, FMDV isolates averaged 80% and 85% nt identity for the S and L fragments, respectively, indicating a high degree of conservation between isolates. This suggests that although the FMDV 5′ UTR can tolerate changes at most positions, selective pressures clearly favor overall conservation, likely for the maintenance of a functional secondary structure. Relatively high rates of substitution (>10) in the 5′ UTR L fragment were observed at positions 513, 558, 615, 684, 696, and 1144 (Fig. 1B).

5′ UTR S fragment.

S fragment lengths averaged 322 and 373 nt for SAT and Euroasiatic isolates, respectively, and spanned positions 1 to 393 in the 5′ UTR alignment (Fig. 1B). SAT viruses contained insertions/deletions of 1 to 3 nt, with most occurring at positions 120 to 160 and 200 to 300, including SAT-specific nt present at positions 38, 39, 67, 95, 250, 350, 366, and 375. Euroasiatic isolates contained insertions/deletions of 1 to 5 nt in length (with the exception of isolates C Waldman strain 149, A Canefa 1/61, and A25 Argentina/59, which contained a 76-nt deletion between positions 153 and 228) and included Euroasiatic-specific nt present at positions 86, 123, 124, 144, 145, 155, 156, 157, 174, 181 to 191, 197 to 219, 240, 256, 277, 292 to 294, 300 to 306, and 324 (Table 3). Notably, SAT1/7 Isrl 4/62 and SAT2-3 Kenya 11/60 appeared to have the most complete S fragment sequences of those sampled, lacking both SAT and Euroasiatic-specific deletions, and contained nt at positions 142, 143, 239, 290, 291, and 307 which were absent from other viruses.
Although the overall nt substitution rates in the S fragment were low, specific regions of variability were observed, and only 19 nt were invariant, excluding the regions used to prime amplification (Fig. 1C and D). S fragment sequences generally grouped into SAT and Euroasiatic lineages, which averaged only 50% nt identity with each other; however, little or no correlation with other serotypic groupings was observed (data not shown). Notably, several isolates of disparate serotypes contained very similar S fragment sequences, including the C Waldman strain 149 and A12 Valle strain 119 S fragments, which shared 98% nt identity.
In most cases, secondary structure analyses of S fragments predicted a single stem-loop structure similar to that previously proposed (12, 24). However, the S fragment sequences of 16% of the isolates folded into alternative structures within similar free energy levels (e.g., strains A22 Turkey/65, A24 Argentina 65, and Asia 1 Leb 83) (data not shown).

5′ UTR L fragment.

The 5′ UTR region of the L fragment ranged from 604 to 751 nt long. Remarkably, apparently unrelated virus isolates contained identical deletions in the L fragment (Table 3). SAT and Euroasiatic-specific L fragment insertions/deletions were identified, as were isolate-specific insertions/deletions, including an 18-nt insertion located 28 nt downstream of the poly(C) tract in strain A5 Westerwald/51.
The pseudoknot region between positions 403 and 600 was highly tolerant to changes, with no invariant nt located within the first 200 positions and insertions/deletions tolerated at each position (Fig. 1C). Previously undescribed invariant nt and motifs located between the pseudoknot region and the IRES included AGAAWYGGGACGU (positions 617 to 629), GCRCACGWAACGCGC (positions 632 to 646), and ACAAAC (positions 668 to 673) within the cre.
FMDV IRES sequences (positions 640 to 1151) showed 70 to 100% nt identity in pairwise comparisons, 47% invariant nt, and numerous invariant motifs in the predicted secondary structure domains (Fig. 1C and D). Domain 2 contained the polypyrimidine tract-binding protein motif UUUC and three previously undescribed motifs at the base, bulge (invariant GGUCUWGAG motif), and apex regions of the stem-loop. Domain 3 contained GYRA (corresponding to the conserved picornaviral GNRA motif) and CRAAA (except in isolates O1Argentina/65 and OAkesu/58) motifs in loops A and B, respectively. While the picornavirus domain 3 loop D motif ACCC was present in 99/103 FMDV isolates, the loop 3C motif ACAC was not conserved in FMDV. Domain 3 also contained novel highly conserved motifs, including the UCGUMGCGGAGCA (positions 823 to 835) motif and GRUACUGGUA and GRGACUGGUA motifs (positions 965 to 974), specific for Euroasiatic and SAT serotypes, respectively, and CUGGWGRCAGGCUAAGGAUGCCCU (positions 983 to 1006), predicted to form a prominent bulge at the base of the stem (Fig. 1C and D). Domain 4 was highly conserved, with two novel invariant motifs (GAUCUGAG [positions 1039 to 1046] and UUAAAAG [positions 1080 to 1087]) predicted to form prominent bulges in the secondary structure. In domain 5, 19 of the 21 nt were invariant (Fig. 1C and D). The conservation of these motifs suggests biological significance. Notably, the 22-nt region between the IRES and the first AUG was highly variable, possibly underlying FMDV's preferential use of the second start codon (9, 66). In summary, the FMDV 5′ UTR, although tolerant for nt substitutions and insertions/deletions, showed significant conservation, especially in the IRES, where novel sequence motifs were identified.

Polyprotein region. (i) Nucleotide sequence and codon analysis.

The nucleotide variability for the 103 FMDV polyprotein (ORF) and individual protein regions is summarized in Table 2. Overall, 46% of all nt were invariant, with 73% nt identity between the least similar pair of sequences. An average transition/transversion (Ts/Tv) rate of 2.4 and syn/nonsyn substitution ratio of 2.1 were observed. As expected, the region encoding 1D was the most variable, exhibiting the lowest percentage of invariant nt (21%), Ts/Tv rate (1.55), and syn/nonsyn ratio (1.03) of all regions. In fact, excluding the highly conserved 1A (VP4) protein, regions encoding structural proteins had significantly lower Ts/Tv rates, nonsyn substitutions/site, and syn/nonsyn ratios than the rest of the genome. Although the substitution rates given here are averages for each protein-coding region, specific regions or residues within each protein were observed to contain higher or lower substitution rates (Fig. 2B and C).
In general, regions encoding FMDV nonstructural proteins were highly conserved between isolates, exhibiting higher percentages of invariant residues, higher Ts/Tv rates and syn/nonsyn substitution ratios, and lower overall numbers of nonsyn changes/site (Table 2; Fig. 2C). The most conserved FMDV regions were those encoding 2B and 3C, which exhibited the highest percentage of invariant nt (61% and 59%, respectively) and amino acids (76%) in the genome. Notably, the nonstructural proteins Lpro, 3A, and 3B exhibited variability comparable to that of the structural proteins 1B, 1C, and 1D (Table 4), suggesting that these proteins are subjected to selective pressures distinct from those on the other nonstructural proteins. A comparison of CODEML ω rates between different substitution models further indicated that four of these proteins (Lpro, 1D, 3A, and 3B) may indeed undergo diversifying selection (Table 4) (116). Notably, this was observed for relatively few codons (1.5% to 7.6%), with fewer highly significant ones (P > 0.9) tending to cluster within each protein (positions 19, 20, 22, 23, and 82 in Lpro; positions 45, 48, 142, 143, 144, and 146 in 1D; positions 44, 132, 135, 136, and 144 in 3A; positions 4 and 11 in 3B1; and positions 17, 18, and 19 in 3B2). Interestingly, the variable capsid proteins 1B and 1C did not appear in this analysis to undergo diversifying selection (Table 4).

(ii) Amino acid sequence analysis.

Fifty-eight percent of all amino acids (aa) were invariant among the FMDV isolates analyzed here, with the percentage of amino acid conservation for each viral protein correlating with nt conservation in the corresponding genomic region (Fig. 3; Tables 2 and 4). Positions at putative protein cleavage sites showed various degrees of sequence conservation, with Euroasiatic lineages being more conserved than SATs. Residues at the 1A/1B, 2A/2B, 2B/2C, 2C/3A, and 3B/3C cleavage sites exhibited high degrees of conservation (Table 5).

Leader proteinase.

FMDV Lpro is expressed as long (Lab) and short (Lb) isoforms that result from alternative usage of either the first or second start codon, respectively, with the sequence between the two AUGs predicted to form a stable hairpin structure crucial to IRES activity (39, 66). Lpro isoforms have indistinguishable activities and specificities and have been proposed to play a role in virulence that may involve the regulation of host interferon responses (89).
Lpro lacked insertions/deletions, with the exception of two additional aa in Euroasiatic lineages (positions 22 and 23). Each methionine start codon was invariant, indicating that both Lpro isoforms are significant for aspects of FMDV biology. Consistent with the previously described hypervariability in the region flanked by the two AUGs, only one residue (C6) was invariant in this region (113). Only 44% of the residues in Lb were invariant, making it much less conserved than was previously reported (30). Although substitutions were concentrated in terminal regions of Lpro, the predicted secondary structure in these regions remained relatively unaltered (data not shown).
A detailed analysis of the Lpro/1A junction resulted in a more ambiguous cleavage motif than was previously described (Table 5) (113). Only GAGXS at the 1A N terminus and the previously described basic residue (K/R) required for cleavage at the Lpro C terminus were invariant. Residues required for Lpro catalytic activity (C52, H149, and D165) (32, 59), suggested to be involved in Lpro autocatalysis (E77) (89), and important for eIF4G cleavage (H110 and H139) (90) were invariant, except for an H110D substitution in all SAT viruses, an E77Q substitution in O6 Pirbright/65, and an E77K substitution in A Phillipines/75 (Table 6). The present FMDV analysis revealed that only 43 of the 65 residues previously identified as conserved between FMDV O1 Kaufbeuren/66 Lpro and the aphthovirus equine rhinitis A virus Lpro were invariant, with 35 of the 43 residues concentrated in three distinct regions (positions 44 to 63, 95 to 110, and 133 to 185) (38) (Table 6). Additional, previously undescribed invariant FMDV Lpro motifs are shown in Table 6.
These data indicate that despite a relatively low overall Lpro aa sequence conservation among the FMDV isolates examined here, functional elements such as the catalytic and cleavage sites and additional, previously undescribed motifs are invariant. The variability observed at the Lpro N and C termini may affect specific virus-host interactions, including ribosomal recognition of alternative start codons.

Structural proteins.

FMDV structural proteins are involved in capsid assembly and stability, virus binding to target cells, and antigenic specificity, influencing significant aspects of virus infection and immunity (45). The high level of variability in FMDV external capsid proteins observed here likely reflects the selective pressures on them.

(i) 1A (VP4).

1A was the most conserved FMDV protein, with 81% of the aa being invariant (Fig. 3; Table 4), including the N-terminal myristylation site and a previously identified heterotypic swine and bovine T-cell epitope (1A positions 20 to 35) (10). Interestingly, the Q73 residue in the SAT viruses distinguishes them from Euroasiatic lineages. Residues potentially specific for SAT2 and SAT3 (I76) and for SAT1 (V80) were also identified.

(ii) 1B (VP2).

1B, a protein of 218 or 219 aa, plays a critical role in virion structural stability and maturation (14). N-terminal regions of 1B contain previously undescribed motifs. For example, DKKTEETTLLEDRILTTRNGHT(T/I)STTQSSVG and DKKTEETT(L/H)LEDRI(L/M/V)TT(S/R)H(G/N)TTTSTTQSSVG are conserved among Euroasiatic and SAT virus isolates, respectively. Three previously identified T-cell epitopes (positions 48 to 68, 114 to 132, and 179 to 187) were conserved (88). Notably, only the N-terminal half of each epitope was invariant, while their C-terminal regions were highly variable.

(iii) 1C (VP3).

1C, a protein of 219 to 221 aa, contains important conformational neutralizing epitopes and makes significant contributions to capsid stability (62). Among the FMDV isolates examined here, 1C was highly variable, with only 39% of the aa being invariant. Most amino acid substitutions were concentrated in four regions (positions 55 to 88, 130 to 140, 176 to 186, and 196 to 208), with insertions/deletions present in the first two regions and a previously described T-cell epitope present in the second region (88). The 1B/1C cleavage site was nearly invariant in Euroasiatic lineages but much less conserved among SAT isolates (Table 5).

(iv) 1D (VP1).

1D is the most studied FMDV protein due to its significance for virus attachment and entry, protective immunity, and serotype specificity (45). 1D ranges in size from 217 to 221 aa, with insertions/deletions contained in regions 140-150 and 166-170. Overall, only 26% of the 1D residues are invariant. The invariant residues and motifs are shown in Fig. 3. Given the available data and the proposed significance of the conserved RGD motif for virus reception and pathogenesis (71, 72), it is notable that complete integrin-binding RGD motifs were lacking in 9 of the 103 FMDV isolates examined here (GGD in C Waldman strain 149 and C4 Tierra del Fuego/66, TGD in C5 Argentina/69, RGE in Asia1/2 Isrl 3/63 and A21 Kenya/64, RDD in A25 Argentina/59 and A Canefa 1/61, HGD in Asia1/3 Kimrom, and PGD in A27 Colombia/67) and in additional sequences present in GenBank (RGN in Asia1 Pak/1/54 and O/Syria/1/87, RSG in A A/IND/110/99, RGE in O KEN/5/95, KGD in O PAK/1/94 and O/IRQ/26/2000, SGD in O Akesu/58, and IGD in O3/Venezuela/51), with substitutions tolerable at any one of the three residues.
Exposure of the 1D N terminus, a region which includes a 10-aa motif which is conserved in several other picornaviruses, is critical for poliovirus entry into the cell (13). The FMDV 1D sequences studied here lack this N-terminal motif, suggesting that some aspects of viral entry may differ from those of other picornaviruses.

Structural implications of capsid protein amino acid conservation.

Picornaviral 1A is cleaved from the 1AB (VP0) precursor by unknown mechanisms, and this cleavage is required for virion maturation and infectivity (6, 74). During poliovirus entry into host cells, 1A is involved in receptor-mediated capsid conformational changes resulting in membrane ion channel formation and the release of viral RNA into the cytoplasm (reviewed in reference 42). Several FMDV residues which are known or suspected to affect 1AB cleavage based on their homology to other picornaviral 1ABs were identified in the FMDV isolates examined here. Notably, a number of these residues were located in previously unidentified invariant sequence motifs, suggesting that the critical function of these residues may be contextual. Specifically, these included 1B residues H145, P144, and L83 and 1C residues G39, F41 (replaced by Y in three isolates), and A50, which is included in the conserved motif LDVAEACPT (positions 45 to 53) (8). Additional residues contributing to the 1AB cleavage pocket include 1D P204, contained in the motif RMKRAE(T/L)YCPR (positions 195 to 205), and 1B V32 (I in SAT2 viruses), T33, and Y36, included in the motif TTSTTQSSVG(V/I)T(Y/F)GY (positions 22 to 36). C-terminal to this last motif lies a putative serotype sequence signature (positions 36 to 47) confirmed for 173 available 1B sequences (YSTXEDHXXGPN in A viruses, YXTXEDFVXGPN in O viruses, YATXEDXXGPN in C viruses, YXVXEDAVSGPN in Asia1 viruses, YAXXDXFLPGPN in SAT1 viruses, YADXDSFRXGPN in SAT2 viruses, and YXSADRFLPGPN in SAT3 viruses) and the motif GPNT(S/N)GLEXRVxQAER(F/Y)(F/Y)K (positions 45 to 63), which is present in all FMDV isolates examined here.
An H-rich region at the 1B/1C interphase is proposed to mediate 1B-1C hydrogen bonding and is likely involved in virion sensitivity to acid, a characteristic with implications for virus stability and transmission (2). 1B residues H21 (position 19 in SAT viruses), H145, H157, and H174 were invariant in all FMDV isolates studied here, while H87P and H168Y substitutions were present in serotype C and Euroasiatic viruses, respectively. In addition, 1C contained five invariant H residues, at positions 86 (84 in SAT viruses), 109, 146, 149, and 198 (196 in SAT viruses).
The N termini of five 1C molecules make up the β annulus at the axis of virion fivefold symmetry, thus contributing to capsid stability (1). The 53 N-terminal residues of 1C, including P4, which is possibly involved in binding to the 3Cpro substrate-binding site, and C7, a residue that is invariant in Euroasiatic isolates and involved in disulfide bonding between 1C N termini, were invariant within serotypes (1). However, all SAT viruses demonstrated an unexpected nonconservative C7V substitution, suggesting that SAT virus capsids may exhibit distinct physical properties.

Nonstructural proteins. (i) 2A.

FMDV 2A is an 18-aa peptide similar to the C terminus of cardiovirus 2A, a protein which induces a modification of the cellular translation apparatus resulting in 2A release (19, 20). The FMDV 2A proteins examined here averaged an 89% amino acid identity. Fourteen residues were identified as ≥98% invariant, including the DVEXNPG motif, which is essential for encephalomyocarditis virus 2A activity (21). The high level of 2A conservation likely reflects structural and functional constraints associated with the small size of the protein.

(ii) 2B.

FMDV 2B localizes to sites of virus genome replication in ER-derived vesicles (106). The 2B protein in other picornaviruses enhances membrane permeability, blocks protein secretory pathways, suppresses apoptotic responses by affecting intracellular Ca2+ homeostasis, and is implicated in virus-induced cytopathic effects (17, 47, 112).
FMDV 2B, a protein of 154 aa, contains 117 invariant residues (Table 4), with amino acid substitutions limited to only one or two alternate residues per site. A previously undescribed, conserved transmembrane domain was predicted between positions 120 and 140, suggesting that 2B is an integral membrane protein and consistent with the proposed localization of 2B to ER-derived vesicles (106).

(iii) 2C.

FMDV 2C is homologous to poliovirus 2C, an ATPase affecting the initiation of minus-strand RNA synthesis and whose precursor, 2BC, induces vesicle formation in the cytoplasm (53). FMDV 2C localizes to membrane-associated virus-replicating complexes (106).
FMDV 2C is 318 aa long and contains 72% invariant residues, including those of the putative ATP/GTP binding domain (positions 110 to 116, 160 to 163, and 243 to 246) (15). Amino acid substitutions unique to individual SAT serotypes were identified between positions 33 and 92.

(iv) 3A.

FMDV 3A has been implicated in virus virulence and host range, similar to the 3A proteins of other picornaviruses (33, 61). Deletions in 3A have been associated with FMDV attenuation in cattle and with the porcinophilic phenotype of O Taiwan/97 (54). However, evidence suggests that other viral genetic determinants are necessary for these phenotypes (54, 81).
FMDV 3A ranges from 143 to 153 aa, with insertions/deletions preferentially occurring at positions 70 to 110 and 130 to 150, regions identified here as containing previously undescribed variability. In fact, 3A is one of the most variable proteins encoded by FMDV, with fewer invariant aa (37%) than the variable capsid proteins 1B and 1C and the highly variable Lpro and contrasting with the high degree of conservation previously reported for a limited number of PanAsia 3A sequences (54). As described above, 3A contains residues predicted to undergo positive selection, including the Q44 residue, at which a Q44R mutation was previously associated with a pathogenic phenotype in guinea pigs (78). Although the Q44R mutation was present in several guinea pig-adapted isolates examined here, this mutation was absent from other isolates adapted to guinea pigs and present in still others that were not adapted to guinea pigs, suggesting that alternative mutations may underlie this particular phenotype. A previously described transmembrane domain (positions 60 through 76) (54) which tolerated conservative amino acid substitutions at all positions except invariant residues L64, L68, A70, and I72 was also variable in this study. Our data revealed limited variability in the potential 3A T-cell epitope that was previously identified between positions 21 and 35 (10). The variable nature of 3A suggests that it may be highly informative for epidemiologic or forensic purposes. Additionally, the likely role for 3A in virulence and host range suggests that interactions with host factors underlie 3A's variability and the diversifying selection predicted to act upon it.

(v) 3B.

FMDV is the only picornavirus to encode multiple 3B proteins (3B1, 23 aa; 3B2, 24 aa; and 3B3, 24 aa), whose homologue in poliovirus primes genomic RNA synthesis during virus replication (26, 85). In our study, 3B1, 3B2, and 3B3 were present in all FMDV isolates. The motif GPYXGP (except for the substitution GPYXRP in Sat 1/20 Rv 11/37), which contains a Y residue homologous to the poliovirus Y3 residue involved in phosphodiester linkage of 3B to the 5′ end of the viral genome, was invariant in the N terminus of each protein (5) (Table 7). The 3B C-terminal regions contained more amino acid variability, including the majority of observed nonconservative substitutions and the fewest invariant residues. Notably, 3B3 was highly conserved in all isolates examined, supporting previous experimental evidence indicating that only this 3B isoform is essential for virus viability (26, 84). 3B1 and 3B2 were more variable, and in fact, contained residues predicted here to undergo diversifying selection (3B1 residues 4 and 11 and 3B2 residues 17, 18, and 19). These data, in conjunction with experimental data indicating that the deletion of 3B1 and 3B2 may affect FMDV virulence and host range (84), suggest that, similar to that of 3A, 3B1 and 3B2 protein variability reflects host range-specific functions.

(vi) 3C.

FMDV 3Cpro is a 213-amino-acid proteinase involved in the cleavage of most viral precursor proteins and of host factors associated with translation (eIF4A and eIF4G) and transcription (histone H3). A previous mutational analysis of 3Cpro identified the catalytic triad residues C163, H46, and D84 and residues critical for proper protein folding, i.e., D84 and Y136, all of which were invariant in the isolates examined here (34). A previously undescribed invariant motif (VKGQDMLSDAALMVLH) and a predicted transmembrane domain were identified at positions 76 to 91 and 27 to 44, respectively. A high degree of overall 3Cpro conservation indicates a limited tolerance for mutations, likely due to significant structural/functional constraints. Despite the 3Cpro conservation, 36 SAT-specific residues were identified, suggesting that distinct selective pressures exist for the two virus groups.

(vii) 3D.

The 469-amino-acid viral RNA-dependent RNA polymerase 3Dpol, responsible for generating minus- and plus-sense genomic RNA, is one of the most conserved FMDV proteins. Our analysis indicated that although it is conserved, 3Dpol is more tolerant of substitutions than was previously reported (56), as our results extended the proportion of variable residues from 8.6% to 26%. D245, N307, and G295, which are essential for maintaining the functional integrity of the picornaviral polymerases (56), were invariant in FMDV 3Dpol, along with other residues described as being highly conserved among all RNA-dependent RNA polymerases (31), including the NTP-binding residues G337, D338, and D339 (115). The previously described picornaviral polymerase peptide motifs KDELR, PSG, YGGD, and FLKR were conserved among all FMDV isolates analyzed (18, 51). Finally, the three previously described hypervariable, hydrophobic antigenic regions of 3Dpol (aa 1 to 12, 64 to 76, and 143 to 153) were also variable in all virus isolates examined here (31).

3′ UTR.

The picornaviral 3′ UTR binds several viral and host proteins and is believed to contain structural cis-acting elements required for negative-strand RNA synthesis (4). Removal of the terminal poly(A) tract or mutagenesis of structural elements abrogates the infectivity of FMDV infectious clones (98). FMDV 3′ UTR sequences stimulate virus-specific, IRES-dependent translation (67) and likely affect other aspects of viral replication, including genome circularization (37).
The FMDV 3′ UTRs were highly variable in length among the isolates, ranging from 85 to 101 nt. A secondary structure analysis of the FMDV 3′ UTR confirmed the Y shape which is also predicted for other picornaviral 3′ UTRs, suggesting that the structure plays an important role in the 3′ UTR function (Fig. 1D and data not shown). A previously unidentified motif was located at the vertex of the Y structure between positions 37 and 61 (Fig. 1C and D). In some cases, however, structural features which could conceivably affect the efficiency of ribosome/RNA dissociation and translation were observed (for example, the exceptionally long stem of A10 Holland/42 and the short stem of O2 Brescia/47) (data not shown).

FMDV phylogenetic and recombination analysis.

To date, phylogenetic analyses have been performed largely on FMDV sequences from the 1D coding region. These analyses have permitted the discrimination among serotypically related FMDV isolates (55). Split decomposition, a clustering technique used previously on 1D sequences to suggest the occurrence of quasispecies evolution in Euroasiatic FMDV (22), was used to examine the complete genome sequences of all 103 isolates described here (Fig. 4A). The results indicated that complex phylogenetic relationships exist between members of different serotypes, including relationships between the A24 Argentina/65 and European/South American O1 viruses; between A12 Valle strain 119 and C Waldman strain 149; between the O1 M11, O2 Brescia/47, and O3 Venezuela/71 viruses and European serotype A viruses; between 05India/62 and Asia1 viruses from Israel; among six SAT1 and three SAT3 viruses; and most notably, between SAT1/7 Isrl 4/62 and SAT2/3 Kenya 11/60 and other SAT1 and SAT2 viruses (Fig. 4A and data not shown).
The data from analyses of individual protein-encoding regions indicated that incongruent tree topologies exist for different genomic regions (data not shown). An analysis of 1B, 1C, 1D, or all of the structural protein-encoding regions together indicated few obvious phylogenetic incongruities, placing viruses into serotypic, temporal, and/or geographic groups (Fig. 4B and data not shown). In general, analyses of the entire structural protein-encoding region improved bootstrap/confidence values relative to 1D analysis alone (data not shown). Conversely, analyses of the 5′ UTR and regions encoding individual or all nonstructural proteins failed to produce the serotype-inclusive groups observed with capsid protein sequences, often yielding unresolved, star-like topologies among diverse serotypes (Fig. 4C and data not shown). Consistent with the complex relationships illustrated in Fig. 4A, analyses of nonstructural protein-encoding regions indicated groupings of serotypically disparate viruses, which extended previous but limited data (54, 110, 113) (Fig. 4C). Similarity plots and bootscanning analysis further indicated that several of these interserotypically related viruses contained nonstructural protein-encoding regions most similar to those of viruses with divergent capsid protein-encoding sequences, suggesting the occurrence of intertypic recombination during the history of these lineages (Fig. 4D to F and data not shown). Examples of potential intratypic recombination were also noted, more obviously in nonstructural protein-encoding regions but also in structural protein-encoding regions, as has been suggested previously (Fig. 4F and G and data not shown) (35, 109).
Taken together, these data suggest that FMDV capsid protein sequences may undergo intertypic recombination infrequently relative to that in other genomic regions, which conceivably undergo complex recombination events and fail to display serotype-specific phylogenetic relationships. These observations are consistent with and extend previous reports of FMDV recombination, which has been inferred from incongruent Lpro, 3Cpro, and 1D topologies and observed (and suggested to predominate) in C-terminal genomic regions (52, 57, 101, 113). Similar observations have recently been made for enterovirus genomes, which were suggested to undergo relatively extensive recombination in nonstructural gene regions while generally maintaining serospecific monophyly (79). These observations, including the inability to reliably define viral relationships based on nonstructural protein-encoding sequences and data suggestive of recombination, raise interesting questions about FMDV genome evolution in nature and the relative contribution of recombination to the generation of FMDV genetic and population diversity.
Notably, the analysis described here identified a novel SAT lineage represented by SAT1-7 Isrl 4/62 and SAT2-3 Kenya 11/60, which contain nonstructural protein-encoding regions that are divergent from each other but are also clearly distinct from those of the other SAT and Euroasiatic lineages presented here (Fig. 4C). The distinct nature of nonstructural proteins from these structurally/serotypically SAT-like viruses was supported by a previously available genome sequence similar to that of SAT2-3 Kenya (SAT2 Ken/3/57; 97% overall nucleotide identity) (Table 1) and by previous data indicating that the SAT2 Ken/3/57 Lpro- and 3C-encoding regions may be distinct from those of other SATs (102). Taken together, these results suggest that more FMDV genome diversity may exist in nature than is currently indicated by serology or 1D sequence analysis.
FIG. 1.
FIG. 1. FMDV UTR variability. (A) FMDV S and L genomic fragments showing the locations and predicted secondary structures of UTRs. Cn, poly(C) tract; AUG, start codons; pAn, poly(A); I, II, and III, S fragment, IRES, and 3′ UTR, respectively. (B) Rates of substitution per nt between positions 1 and 1218 and positions 8277 and 8441 in a genomic ClustalW alignment. Arrows with numbers indicate positions with high rates of nt substitution. (C) 5′ UTR nt conservation between positions 1 and 1153 for the 103 FMDV isolates examined in this study. Motifs previously defined as conserved between picornavirus IRESs are underlined. Boxes indicate primers used for amplification. Asterisks indicate nt positions tolerant to insertions/deletions in two or more isolates. (D) Nucleotide conservation within S fragment (I), IRES (II), and 3′ UTR (III) predicted secondary structures. Arrows indicate regions used for PCR amplification. UTR regions from the isolate C5Argentina/69 were used to generate secondary structure predictions and plots with mfold and Squiggles. Black circles indicate invariant nt among the 103 isolates presented here; gray circles represent nt that are conserved in at least 100 of 103 isolates (96%); gray shading indicates residues comprising previously described motifs. Nucleotide position numbers correspond to the consensus sequence generated by a ClustalW alignment of the 103 isolates.
FIG. 2.
FIG. 2. FMDV coding region variability. (A) Schematic diagram of FMDV polyprotein coding region showing the positions of, from top to bottom, protein-encoding regions (open boxes), cleavage intermediates, and mature proteins (lines). (B) Graphic representation of rates of nt substitution per site as calculated with DNArates software. (C) Graphic representation of nonsynonymous substitutions per site as calculated with SNAP software.
FIG. 3.
FIG. 3. FMDV invariant amino acids (single letter code). The consensus sequence is based on the comparison of 103 FMDV isolates conducted for this study, with the exception of the 1D region, which also included all 1D sequences available in GenBank (release 141).
FIG. 4.
FIG. 4. FMDV phylogenetic and recombination analysis. (A) One hundred three FMDV genomes were aligned with ClustalW and visually screened for reticulated branching patterns by split decomposition cluster analysis, using SplitsTree with Hamming distances. Numbers at terminal nodes correspond to the isolates presented in Table 1, arcs and labels indicate serotype-specific groups, similar colors indicate isolates exhibiting obvious interserotypic relationships, red stars indicate SAT viruses with unique nonstructural protein sequences, and bars represent estimated distances. Similar results were obtained with alternative corrections for multiple substitution (data not shown). Subgenomic split decomposition analysis was conducted on structural protein (1A to 1D) (B) and nonstructural protein (Lpro and 2A to 3D) (C) coding regions aligned with Dialign. (D to G) Similarity (upper box) and bootscanning (lower box) plots were generated with a query isolate against reference isolates aligned with Dialign, indicating corrected percent similarities and bootstrap frequencies as percentages of permuted trees, respectively. Polyprotein schematics are shown above the similarity plots. Query isolates are indicated at the left within similarity plots and included the following: (D) SAT 1/7 Isrl 4/62 (no. 96), (E) A24 Argentina/65 (no. 3), (F) O1 M11 (no. 74), and (G) A10 Holland/42 (no. 25). Reference isolates are indicated individually or as groups in color, as labeled at the right within similarity plots, and included the following: (D) red, SAT 2/3 Kenya 11/60 (no. 99); green, SAT1 viruses (no. 88 to 95); blue, SAT2 and SAT3 viruses (no. 97 and 98 and 100 to 103, respectively); black, A viruses (no. 30, 38, and 46), O viruses (no. 80 and 86), C viruses (no. 57), and Asia1 viruses (no. 51); (E) green, A14 Spain/59 (no. 36); orange, A29 Peru/69 (no. 22); blue, A viruses (no. 2, 10, 18, 19, 22, 25, 27, 30, 38, 39, 42, 46, and 47); red, O1 Campos/58 (no. 70); gray, O viruses (no. 74, 78, 80, 83, and 87); (F) red, A10 Holland/42 (no. 25); pink, A1 Bayern/Bavaria (no. 27); green, A4 WG/72 (no. 30); blue, A viruses (no. 2, 10, 18, 19, 22, 38, 39, 42, 46, 47); black O1 Campos/58 (no. 70); orange, O1 Vallee/39 (no. 77); gray, O viruses (no. 63, 75, 77, 78, 80, 83, 87); (G) red, A12 Valle Strain 119 (no. 26); pink, A1 Bayern/Bavaria (no. 27); orange, A3 Mecklenburg/68 (no. 28); green, A4 WG/72 (no. 30); blue, A viruses (no. 2, 3, 5, 10, 13, 17, 19, 21, 22, 29, 32, 33, 36 to 39, 41, 46, and 47). Aligned polyprotein-encoding nt positions are indicated below the bootscan plots. Colored bars within similarity plot boxes indicate fragments identified by GENECONV as having significant global permutation values (P < 0.05) shared between the query sequence and particular reference sequences.
TABLE 1.
TABLE 1. FMDV sequences
Sequence no.cIsolate nameaCountry, year of isolationPassage historybAccession no.
1A25 Argentina/59Argentina, 1959GP, 1 LKAY593769
2A Canefa 1/61Argentina, 1961BOV 2 LKAY593789
3A24 Argentina/65Argentina, 1965BOV, 3 LKAY593767
4A26 Argentina/66*Argentina, 19668 GPAY593770
5A Argentina/00Argentina, 2000BOVAY593782
6A Argentina/01 ArecoArgentina, 2001BOVAY593783
7A ARGp55/01Argentina, 2001BHK-21 passage 55AY593784
8A ARGp64/01Argentina, 2001BHK-21, passage 64AY593785
9A Trenquelauquen/01Argentina, 2001BOVAY593786
10A General Lopez/01Argentina, 2001BOVAY593790
11A Uruguay/01Uruguay, 2001BOVAY593801
12A Uruguay/98Uruguay, 2001BHK-21AY593802
13A Bage/77*Brazil, 19772 BTTAY593787
14A Brazil/79Brazil, 19791 BHK-21, 1 IBRS-2AY593788
15A Venceslau/76Brazil, 19765 BHK-21, BTTAY593803
16A13 Brazil /70Brazil, 19707 GPAY593753
17A16 Belem/59Brazil, 1959BOV, 1 LKAY593756
18A17 Aguarulbos/67Brazil, 19673 BOV, 3 LKAY593757
19A24 Cruzeiro/55Brazil, 19555 BHK-21, 5 IBRS-2AY593768
20A Sabana/85Colombia, 19851 BTT, 1 BHK-21, 1 IBRS-2AY593794
21A27 Colombia/67Colombia, 196710 GPAY593771
22A29 Peru/69Peru, 1969GP, 1 LKAY593773
23A18 Zulia/67Venezuela, 19671 BK, 10 GP, 2 LKAY593758
24A32 Venezuela/70Venezuela, 19701 BOV, LKAY593775
25A10 Holland/42Holland, 19421 IBRS-2AY593751
26A12 Valle Strain 119*Great Britain, 193277 BOVAY593752
27A1 Bayern/BavariaGermany, 1971GP, 1 IBRS-2AY593759
28A3 Mecklenburg/68Germany, 19681 BOV, 1 LKAY593776
29A5 Westerwald/51*West Germany, 1951ET, BTTAY593781
30A4 WG/42West Germany4 BTT, 4 BHK-21AY593777
31A4 WG/72West Germany, 19721 BOV, 1 LKAY593779
32A5 Allier/60France, 19603 GP, 4 BT, 4 BHK-21AY593780
33A8 Parma/62Italy, 1962BOV, 1 LKAY593792
34A4 Spain*SpainET, 1 BTTAY593778
35A2 Spain/69Spain, 19691 LKAY593774
36A14 Spain/59Spain, 1959BOV, 1 LKAY593754
37A Philippines/75Philippines, 19754 GP, 2 LKAY593793
38A15 Thailand/60Thailand, 19601 BOV, 3 LKAY593755
39A22 Turkey/65*Turkey, 19652 BTTAY593765
40A28 Turkey/72Turkey, 19721 LKAY593772
41A20 USSR 1/64USSR, 19642 LKAY593760
42A Iran/1/98Iran, 19981 BOVAY593791
43A22 Iraq 24/64Iraq, 19644 BTT, 1 LKAY593762
44A22 Iraq 26/64*Iraq, 19643 BOVAY593763
45A22 Iraq/70Iraq, 19702 LKAY593764
46A21 Kenya/64Kenya, 19649 GPAY593761
47A23 Kenya 6/65Kenya, 19652 LKAY593766
48Asia 1 Leb 1/83*Kfar Kela/Lebanon, 19832 PK, 2 BTTAY593799
49Asia 1 Leb 2/83*Lebanon, 19832 BOVAY593800
50Asia 1 Leb 3/83*Southern Lebanon, 19832 PK, 2 BTTAY593798
51Asia 1/1 PAK/54Pakistan, 19546 BTT, 2 LKAY593795
52Asia 1/2 ISRL 3/63Israel, 1963BOV, 7 GPAY593796
53Asia 1/3 KimronIsrael, 1963BOV, 9 GPAY593797
54C Waldman strain 149*Great Britain, 1970BTTAY593810
55C1 Noville/65Switzerland, 19652 PI, BHK-21AY593804
56C1 Oberbayern/60*Germany, 1960BHK-21AY593805
57C3 Indaial/71Brazil, 19712 BHK-21AY593806
58C3 Resende/55Brazil, 19551 LKAY593807
59C4 Tierra del Fuego/66Tierra del Fuego, Argentina, 19661 LKAY593808
60C5 Argentina/69Argentina, 19695 BHK-21, 5 GPAY593809
61O Rey Iran/66Iran, 1966BTT, BK, 1 LKAY593834
62O Uruguay/63Uruguay, 1963BK, 2 LKAY593837
63O UK 2001*United Kingdom, 2001BVFAY593836
64O UK2001-EDPlum Island, 20021 BHK-21AY593831
65O UK2001-FBPlum Island, 20022 BHK-21AY593832
66O1 Argentina/65Argentina, 19652 BTT, 1 LKAY593814
67O1 BFS18/67United Kingdom1 LKAY593815
68O1 BFS46/67United Kingdom2 BHK-21AY593816
69O1 BruggeBelgium, 19731 LKAY593817
70O1 Campos/58Brazil, 19581 BTTAY593818
71O1 Campos/94Plum IslandBHK-21AY593819
72O1 Canefa/64*Argentina, 19642 BTTAY593820
73O1 Caseros/67*Argentina, 19674 BTTAY593821
74O1 M11*Unknown, 1953BTTAY593822
75O1 Manisa/69*Turkey, 1969BVFAY593823
76O1 SKR/00*S. Korea, 2000Swine epitheliumAY593824
77O1 Vallee/39*Pirbright, 1953Bovine epitheliumAY593825
78O10 PhilippinesPhilippines/581 LKAY593811
79O10 Philippines 2/58*Philippines/58BTY, BK, BOVAY593812
80O11 Indonesia/62Indonesia, 1962BTT, 2 LKAY593813
81O2 Brescia/47Italy, 19471 LKAY593826
82O3 Venezuela/71Venezuela, 1971BTT, 1 LKAY593827
83O5 India/62*India, 19621 BK, 1 BTTAY593828
84O6 Pirbright/65United Kingdom /654 GPAY593829
85O7 Poland/59Poland, 19591 LKAY593830
86O Taiwan/97Taiwan, 1997Swine epitheliumAY593835
87O Penghu/99Taiwan, 1999Swine epitheliumAY593833
88SAT 1 BOT 1/68Botswana (BEC), 19683 BTY, 5 BHK-21AY593845
89SAT 1 Rhod5/66*Rhodesia, 19661 BTTAY593846
90SAT 1/1 BECBotswana (BEC), 19702 LKAY593838
91SAT 1/20 RV 11/37Pirbright, WRL, 19703 IBRS-2AY593839
92SAT 1/3 SWA1/49Unknown, 19704 IBRS-2AY593840
93SAT 1/4 SR2/58Rhodesia, 19703 IBRS-2AY593841
94SAT 1/5 SA/61Unknown, 19723 IBRS-2AY593842
95SAT 1/6 SWA40/61Unknown, 19703 IBRS-2AY593843
96SAT 1/7 ISRL 4/62Israel, 19623 IBRS-2AY593844
97SAT 2/1 Rhod/48Rhodesia, 19483 IBRS-2AY593847
98SAT 2/2 106/67Unknown, 19702 IBRS-2AY593848
99SAT 2/3 Kenya 11/60Kenya, 19603 IBRS-2AY593849
100SAT 3/2 SA57/59Unknown, 19691 LKAY593850
101SAT 3/3 BEC20/61Botswana (BEC), 19612 LKAY593851
102SAT 3/3 Kenya 11/60Kenya, 19604 IBRS-2AY593852
103SAT 3/4 BEC 1/65Botswana (BEC), 19651 LKAY593853
104O/JPN/2000JapanBEF, 4 BKAB079061
105O strain Chu-PeiTaiwanSwineAF026168
106OTau-YuanTW97TaiwanUnknownAF154271
107O1 GeshureIsraelUnknownAF189157
108O1 YunlinTaiwanSwineAF308157
109O/SK 2000South KoreaUnknownAF377945
    AY312586
 O/SK 2002South KoreaUnknownAY312588
110O Tibet /1/99ChinaUnknownAF506822
111O Akesu/58ChinaBOVAF511039
112SAT 2 ZIM/7/83Zimbabwe, cloneVaccine strain, clonedAF540910
113A12-strain 119United KingdomTissue culture, clonedM10975
114Asia 1 IND 63/72India, vaccineVaccine strain, unknownAY304994
115A22/550 Azerbaijan 65USSRUnknownX74812
116O-HKN/2002ChinaUnknownAY317098
117O strain OMIIIAttenuated from strain Akesu/58UnknownAY359854
118Asia1 YNBS/58ChinaUnknownAY390432
119C rp99C-S8c1 derivativePersistently infected BHK-21 cells, passage 99FAN133358
120C rp146C-S8c1 derivativePersistently infected BHK-21 cells, passage 146FAN133359
121C-s8c1Spain (Olot)BHK-21FDI133357
122SAT 2 KEN/3/57KenyaUnknownFDI251473
123O1CamposBrazilTissue culture, clonedFDI320488
124C3Arg85ArgentinaBHK-21FMV7347
125C3Arg85 Rb-15C3Arg85 derivativePartially resistant BHK-Rb cellsFMV7572
126TAW/2/99 TCTaiwanBEF, 3 BHK-21, 1 BTY, 2 BHK-21AJ539136
127TAW/2/99 BOVTaiwanBEF, 3BHK-21, 1BTY, 2BHK-21, 1 BOV, 2 swine, 1 BOVAJ539137
128Tibet/CHA/99China1 BOV, 3 BHK-21AJ539138
129O/SK 2000South KoreaBOV,1 BHK-21AJ539139
130SAR/19/2000South AfricaBOV, 2 PK, 1 IBRS-2, 1 BHK-21AJ539140
131UKG/35/2001United Kingdom2 swineAJ539141
132A10-61ArgentinaUnknown, clonedPIFMDV1
133O1-Kaufbeuren/66GermanyBHK-21, clonedPIFMDV
a
*, RNA was extracted directly from tissue or vesicular fluid.
b
BHK, BHK21 baby hamster kidney cells; LK, PK, and BK, lamb, porcine, and bovine kidney cells, respectively; BTY, bovine thyroid cells; IBRS-2, porcine kidney epithelial cell line; ET, epithelial tissue; BTT, bovine tongue tissue; GP, guinea pig vesicular fluid; BOV, bovine; BVF, bovine vesicular fluid; BEF, bovine esophageal fluid.
c
Sequence numbers 104 to 133 are FMDV sequences from GenBank.
TABLE 2.
TABLE 2. FMDV genome variabilitya
UTR or genome regionNo. of nt positions alignedNo. of invariant nt% Invariant ntTs/Tv rate (%)Average pairwise identity (%)Minimum pairwise identity (%)
5′ UTR1,150303262.898364
S-UTR39348123.938051
L-UTR757255332.638570
3′ UTR1611593.938263
ORF7,0763,287462.448473
Lpro606227373.238061
1A255143562.538473
1B660243371.757562
1C675235351.847558
1D693147211.556848
2A4823482.648973
2B462282616.679181
2C953527555.148978
3A459160353.758568
3B21696445.518969
3C639380594.128977
3D1,410824585.539183
a
Estimates were based on ClustalW (UTR data) or Dialign (ORF data) alignments of the 103 FMDV isolates examined. The number of invariant nt for each genomic region relative to the total number of positions was used to estimate the percentage of invariant nt. The ratio of transitions to transversions (Ts/Tv) was obtained by using Distree and Kimura 2 parameter correction with gamma distributions. ALISTAT was used to obtain the average % pairwise identity and the minimum pairwise identity. The 5′ UTR includes the S and L fragments 5′ of the first AUG. The S-UTR includes nt from position 1 to the poly(C) tract. The L-UTR includes nt from the end of the poly(C) tract to the first AUG. The 3′ UTR includes nt from the polyprotein stop codon to the poly(A) tail.
TABLE 3.
TABLE 3. Selected FMDV 5′ UTR insertions/deletions
Isolate or fragmentant positions 
 InsDels
S  
    A1 Bayern/Bavaria 80-82
A3 Mecklenburg/68 80-82
A Canefa 1/61 114
A25 Argentina/59 114
Asia 1/1 PAK/54 114
O11 Indonesia/62 114
SAT 1/7 ISRL 4/62142, 143 
SAT 2/3 Kenya 11/60142, 143 
C Waldman strain 149* 153-228
A25 Argentina/59 153-228
A Canefa 1/61 153-228
A24270 
O1 Argentina270 
SAT 1/7 ISRL 4/62290, 291 
SAT 2/3 Kenya 11/60290, 291 
A Argentina/01 Areco 290-293
A ARGp55/01 290-293
A ARGp64/01 290-293
A General Lopez/01 290-293
A Trenquelauquen/01 290-293
A Uruguay/01 290-293
A Uruguay/98 290-293
O UK 2001 292
O UK 2001-ED 292
O UK 2001-FB 292
O1 SKR/00 292
A22 Azerbaijan320 
A22 Iraq24/64320 
A22 Iraq26/64320 
A22 Turkey/65320 
A28 Turkey/72320 
A22 Turkey/65 364-366
A28 Turkey/72 364-366
L  
A28 Turkey/72 418-478
O1 Vallee/39 418-478
O5 India/62* 418-478
O Akesu/58 418-478
O Akesu/58 vaccine 418-501
C1 Noville/65 418-478
C1 Oberbayern/60* 418-478
C-s8c1 Spain 418-478
C-Perst.inf.BHKp99 418-478
C-Perst.inf.BHKp146 418-478
SAT 1/7 ISRL 4/62 418-487
A24 Cruzeiro/55 427-487
A21 Kenya/64 427-487
A20 USSR 1/64 427-487
O11 Indonesia/62 427-487
SAT 2/3 Kenya 11/60 427-487
SAT 1/20 RV 11/37 427-487
SAT 1 Rhod5/66* 427-487
SAT 2/1 Rhod/48 427-487
SAT 2/2 106/67 427-487
SAT 3-4 BEC 1/65 427-487
A5 Westerwald/51*427-443 
O Penghu/99 460-502
O Yunlin Tw97 460-502
O HKN/2002 460-502
O Taiwan/97 460-502
A26 Argentina/66* 419-523
A16 Belem/59 419-523
O11 Indonesia/62 523-546
Asia1-IND 63/72 554-591
A3 Mecklenburg/68 554-591
A4 Spain* 554-591
A2 Spain/69 554-591
A4 WG/72 554-591
A1 Bayern/Bavaria 554-591
A10 Holland/42 554-591
O1 M11 554-591
O2 Brescia/47 554-591
O3 Venezuela/71 554-591
a
*, isolates from which RNA was extracted directly from tissue or vesicular fluid.
TABLE 4.
TABLE 4. FMDV genome variability in encoded amino acid sequencesa
Genome regionNo. of aa positions alignedNo. of invariant aa% Invariant aaSNAP result  CODEML result  
    SynNonsynSyn/nonsynωtPS
ORF2,3601,363587563622.08NDNDND
Lpro202894470451.550.2720.8Y
1A8468813356.60.0122.5N
1B22110347100631.60.0634.9N
1C225873999631.60.0832.9N
1D2325624102991.030.1635.8Y
2A17116550.529.6NDNDND
2B1531177635750.068N
2C3182287283184.60.0610.5N
3A153573744212.10.1612.7Y
3B7236501762.80.338.2Y
3C2131637655143.90.0411.3N
3D47134874113205.60.068.4N
a
The synonymous/nonsynonymous (syn/nonsyn) substitutions were estimated by use of the Nei and Gojobori algorithm as implemented in SNAP. Estimates for diversifying positive selection were obtained by using codeml. ω, nonsyn/syn ratio averaged over sites (dN/dS); t, maximum-likelihood tree length measured by the number of nt substitutions along the tree per codon; PS, positive selection; Y, yes; N, no; ND, not done.
TABLE 5.
TABLE 5. FMDV polyprotein cleavage site variabilitya
Junc- tionCommon amino acids for serotype                                                    
 ALL (n = 133)        SAT (n = 16)        A (n = 46)        O (n = 23)        C (n = 7)        Asia (n = 6)       
L/1ARKLK*GAGQLFLR*GAGQRKLK*GAGQRKLK*GAGQRKLK*GAGQKRLK*GAG
 K46R46V3R36H3A1Y2V2K2H1K9R10H1K8R7R2Q2R1
 L15F15T1Q4N1
 T1Y3W1
 Q6N1
 A2
 W1
1A/1BALLA*DKKTALLA*DKKTALLA*DKKTALLA*DKKTALLA*DKKTALLA*DKK
 T1T1
1B/1CPSKE*GIFPPAKQ*GILPPSKE*GIFPPSKE*GIFPPSKE*GIFPPSKE*GIV
 A10Q17V1V21S3E2I6Q1V10
 V2I7V2V2
 G2L7G1F1
 M1M1
1C/1DPRTQ*TTSTPSRQ*TTSAPRQQ*TTATARTQ*TTSAARQQ*TTTTARQQ*TTT
 A67S8Q27E14A43A51V3T2V2P10T7V7A9E10T6R2A3A1R2
 T1V5R26T23V9A2A2S10S4A3R5P1
 A2A16P2T2T7V1
 T2P14L1C1A3
 C1S12S1L1
 V1R1
 L1
1D/2APAKQ*LLNFPAKQ*LCNFPAKQ*LLNFPVKQ*TLNFPAKQ*LLNFPEKQ*VLN
 V5G1R1S1C12S1C1V3E6M3L1S1C1E8R3A2L7E1S2L1
 E25T19S3D2A1G1T2T1
 T2A2A1V1S1T1A1
 S1V4F1F1V1
 V38M3
 K1
 D2
2A/2B*SNPG*PFFFSNPG*PFFFSNPG*PFFFSNPG*PFFFSNPG*PFFFSNPG*PFF
 P2L1R1L2S1L2P1
2B/2CAEKQ*LKARAEKQ*LKARAEKQ*LKARAEKQ*LKARAEKQ*LKARAEKQ*LKA
 R3R1R1
2C/3AIFKQ*ISIPIFKQ*ISIPIFKQ*ISIPIFKQ*ISIPIFKQ*ISIPIFKQ*ISI
 L1L2L2T1V1
 T3
 V1
3A/3BPQAE*GPYAPQAE*GPYAPQAE*GPYAPQAE*GPYAPQAE*GPYAPQAE*GPY
 R9T2T24K1T1R3T1T3T4T1
 H5S2H1H4V1
 K1V1
3B/3CIVTE*SGAPIVTE*SGCPIVTE*SGAPIVE*SGAPIVTE*SGAPIVTE*SGA
 T1C15T1A2
3C/3DPHHE*GLIVPHTE*GLVVPHHE*GLIVPHHE*GLIVPHHE*GLIVPHHE*GLI
 Q2T13V16L1H2I2L1I1V1
 I2N1
a
Individual columns and rows represent FMDV serotypes and protein junctions, respectively. The first line in each row indicates the most frequent amino acid for each position, with alternative amino acids listed below and subscripts indicating the number of isolates with that particular residue. The total number (n) of isolates compared within each serotype is indicated at the top. *, protein cleavage point.
TABLE 6.
TABLE 6. Amino acid conservation in FMDV and ERAV Lpro
Position no.a1630, 3137404244-4751-5558-6366, 677375, 7680 
FMDVbMCMEGKFSRPNNCWLNQLFRYEPYSPT 
FMDV/ERAVcM      NCWLNQL   T 

              

              
Position no.8791939598-102104106108-110112114, 115117, 118121-124126130
FMDVLTLLGGPPAVWIK(H/D)LTGGTRPSECG
FMDV/ERAV T LG PPV    GTP G

              

              
Position no.133-143145, 146149-153156159, 160162164-166169-173175178, 179183-185187-189  
FMDVM(C/T)LADFHAGIFKGHAVFATGWADDEYPWTPPVLVPYDEP  
FMDV/ERAVL DF AKHAVFTGW DDYP TP VLPYD   
a
Numbers indicate Lpro amino acid positions from the first polyprotein AUG of Dialign-aligned FMDV polyproteins.
b
Invariant Lpro residues among 133 FMDV isolates. The proteolytic active sites C52 and H149 are shown in bold.
c
Invariant Lpro residues between FMDV and ERAV sequences (38).
TABLE 7.
TABLE 7. FMDV 3B (VPg) variability
SerotypeSequencea                       
3B1GPYA*GPLERQK*PLKVRAKLPQQ E
 T23M3Q14R2L14K38T5E4P1R6A14  
 S2V1R19V2R1F1K4H5  
 I1R1 
3B2GPYAGPMERQKPLKVKA*K*A*PVVKE
 V3R1L23D1K10Q18R3L15R4V29R21L15S1A16R1
 T4T3I4 
 E1N/P/V1 
3B3GPYEGPVKKPVALKVKAKNLIVTE
 D1M1R1R1A1L1R1T2R1A15P 15  
 M3 
a
The most frequent amino acid for each position is shown in the top row for each serotype; alternative amino acids and the number of isolates with that particular residue (subscripts) are listed below. SAT serotype-specific residues are shown in italics. Asterisks indicate positions predicted to undergo diversifying selection by codeml analysis.

Acknowledgments

We thank J. Lubroth for providing FMDV isolates and A. Lakowitz and A. Zsak for providing excellent technical assistance.

Supplemental Material

File (supptable1.doc)
File (supptable2.doc)
ASM does not own the copyrights to Supplemental Material that may be linked to, or accessed through, an article. The authors have granted ASM a non-exclusive, world-wide license to publish the Supplemental Material files. Please contact the corresponding author directly for reuse.

REFERENCES

1.
Acharya, R., E. Fry, D. Stuart, G. Fox, D. Rowlands, and F. Brown. 1990. The structure of foot-and-mouth disease virus: implications for its physical and biological properties. Vet. Microbiol.23:21-34.
2.
Acharya, R., E. Fry, D. Stuart, G. Fox, D. Rowlands, and F. Brown. 1989. The three-dimensional structure of foot-and-mouth disease virus at 2.9 Å resolution. Nature (London)337:709-716.
3.
Afonso, C. L., E. R. Tulman, Z. Lu, E. Oma, G. F. Kutish, and D. L. Rock. 1999. The genome of Melanoplus sanguinipes entomopoxvirus. J. Virol.73:533-552.
4.
Agol, V. I., A. V. Paul, and E. Wimmer. 1999. Paradoxes of the replication of picornaviral genomes. Virus Res.62:129-147.
5.
Ambros, V., and D. Baltimore. 1978. Protein is linked to the 5′ end of poliovirus RNA by a phosphodiester linkage to tyrosine. J. Biol. Chem.253:5263-5266.
6.
Ansardi, D. C., D. C. Porter, and C. D. Morrow. 1992. Myristylation of poliovirus capsid precursor P1 is required for assembly of subviral particles. J. Virol.66:4556-4563.
7.
Bandelt, H. J., and A. W. Dress. 1992. Split decomposition: a new and useful approach to phylogenetic analysis of distance data. Mol. Phylogenet. Evol.1:242-252.
8.
Basavappa, R., R. Syed, O. Flore, J. P. Icenogle, and D. J. Filman. 1994. Role and mechanism of the maturation cleavage of VP0 in poliovirus assembly: structure of the empty capsid assembly intermediate at 2.9 A resolution. Protein Sci.3:1651-1669.
9.
Belsham, G. J. 1992. Dual initiation sites of protein synthesis on foot-and-mouth disease virus RNA are selected following internal site and scanning of ribosomes in vivo. EMBO J.11:1105-1110.
10.
Blanco, E., M. Garcia-Briones, A. Sanz-Parra, P. Gomes, E. De Oliveira, M. L. Valero, D. Andreu, V. Ley, and F. Sobrino. 2001. Identification of T-cell epitopes in nonstructural proteins of foot-and-mouth disease virus. J. Virol.75:3164-3174.
11.
Brendel, V., P. Bucher, I. Nourbakhsh, B. E. Blaisdell, and S. Karlin. 1992. Methods and algorithms for statistical analysis of protein sequences. Proc. Natl. Acad. Sci. USA89:2002-2006.
12.
Clarke, B. E., A. L. Brown, K. M. Currey, S. E. Newton, D. J. Rowlands, and A. R. Carroll. 1987. Potential secondary and tertiary structure in the genomic RNA of foot-and-mouth disease virus. Nucleic Acids Res.15:7067-7079.
13.
Curry, S., M. Chow, and J. M. Hogle. 1996. The poliovirus 135S particle is infectious. J. Virol.70:7125-7131.
14.
Curry, S., E. Fry, W. Blakemore, R. Abu-Ghazaleh, T. Jackson, A. M. King, S. Lea, J. Newman, and D. Stuart. 1997. Dissecting the roles of VP0 cleavage and RNA packaging in picornavirus capsid stabilization: the structure of empty capsids of foot-and-mouth disease virus. J. Virol.71:9743-9752.
15.
Dever, T. E., M. J. Glynias, and W. C. Merrick. 1987. GTP-binding domain: three consensus sequence elements with distinct spacing. Proc. Natl. Acad. Sci. USA84:1814-1818.
16.
Devereux, J., P. Haeberli, and O. Smithies. 1984. A comprehensive set of sequence analysis programs for the VAX. Nucleic Acids Res.12:387-395.
17.
Doedens, J. R., and K. Kirkegaard. 1995. Inhibition of cellular protein secretion by poliovirus proteins 2B and 3A. EMBO J.14:894-907.
18.
Doherty, M., D. Todd, N. McFerran, and E. M. Hoey. 1999. Sequence analysis of a porcine enterovirus serotype 1 isolate: relationships with other picornaviruses. J. Gen. Virol.80:1929-1941.
19.
Donnelly, M., L. Hughes, G. Luke, H. Mendoza, E. ten Dam, D. Gani, and M. Ryan. 2001. The “cleavage” activities of foot-and-mouth disease virus 2A site-directed mutants and naturally occurring “2A-like” sequences. J. Gen. Virol.82:1027-1041.
20.
Donnelly, M., G. Luke, A. Mehrotra, X. Li, L. Hughes, D. Gani, and M. Ryan. 2001. Analysis of the aphthovirus 2A/2B polyprotein “cleavage” mechanism indicates not a proteolytic reaction, but a novel translational effect: a putative ribosomal “skip.” J. Gen. Virol.82:1013-1025.
21.
Donnelly, M. L., D. Gani, M. Flint, S. Monaghan, and M. D. Ryan. 1997. The cleavage activities of aphthovirus and cardiovirus 2A proteins. J. Gen. Virol.78:13-21.
22.
Dopazo, J., A. Dress, and A. V. Haeseler. 1993. Split decomposition: a technique to analyze viral evolution. Proc. Natl. Acad. Sci. USA90:10320-10324.
23.
Duke, G. M., J. E. Osorio, and A. C. Palmenberg. 1990. Attenuation of Mengo virus through genetic engineering of the 5′-noncoding poly(C) tract. Nature343:474-476.
24.
Escarmis, C., M. Toja, M. Medina, and E. Domingo. 1992. Modification of the 5′ untranslated region of foot-and-mouth disease virus after prolonged persistence in cell culture. Virus Res.26:113-125.
25.
Ewing, B., L. Hillier, M. C. Wendl, and P. Green. 1998. Base-calling of automated sequencer traces using Phred. I. Accuracy assessment. Genome Res.8:175-185.
26.
Falk, M., F. Sobrino, and E. Beck. 1992. VPg gene amplification correlates with infective particle formation in foot-and-mouth disease virus. J. Virol.66:2251-2260.
27.
Felsenstein, J. 1993. PHYLIP (Phylogeny Inference Package), version 3.5c. Distributed by the author. Department of Genetics, University of Washington, Seattle.
28.
Galtier, N., M. Gouy, and C. Gautier. 1996. SeaView and Phylo_win, two graphic tools for sequence alignment and molecular phylogeny. Comput. Applic. Biosci.12:543-548.
29.
Garnier, J., D. J. Osguthorpe, and B. Robson. 1978. Analysis of the accuracy and implications of simple methods for predicting the secondary structure of globular proteins. J. Mol. Biol.120:97-120.
30.
George, M., R. Venkataramanan, C. B. Gurumurthy, and D. Hemadri. 2001. The non-structural leader protein gene of foot-and-mouth disease virus is highly variable between serotypes. Virus Genes22:271-278.
31.
George, M., R. Venkataramanan, B. Pattnaik, A. Sanyal, C. B. Gurumurthy, D. Hemadri, and C. Tosh. 2001. Sequence analysis of the RNA polymerase gene of foot-and-mouth disease virus serotype Asia1. Virus Genes22:21-26.
32.
Gorbalenya, A. E., E. V. Koonin, and M. M. Lai. 1991. Putative papain-related thiol proteases of positive strand RNA viruses. Identification of rubi- and aphthovirus proteases and delineation of a novel conserved domain associated with proteases of rubi-, alpha-, and coronaviruses. FEBS Lett.288:201-205.
33.
Graff, J., C. Kasang, A. Normann, M. Pfisterer-Hunt, S. M. Feinstone, and B. Flehmig. 1994. Mutational events in consecutive passages of hepatitis A virus strain GBM during cell culture adaptation. Virology204:60-68.
34.
Grubman, M. J., M. Zellner, G. Bablanian, P. W. Mason, and M. E. Piccone. 1995. Identification of the active-site residues of the 3C proteinase of foot-and-mouth disease virus. Virology213:581-589.
35.
Haydon, D. T., A. D. S. Bastos, and P. Awadalla. 2004. Low linkage disequilibrium indicative of recombination in foot-and-mouth disease virus gene sequence alignments. J. Gen. Virol.85:1095-1100.
36.
Henikoff, S., and J. G. Henikoff. 1994. Protein family classification based on searching a database of blocks. Genomics19:97-107.
37.
Herold, J., and R. Andino. 2001. Poliovirus RNA replication requires genome circularization through a protein-protein bridge. Mol. Cell7:581-591.
38.
Hinton, T., N. Ross-Smith, S. Warner, G. Belsham, and B. Crabb. 2002. Conservation of L and 3C proteinase activities across distantly related aphthoviruses. J. Gen. Virol.83:3111-3121.
39.
Hinton, T. M., F. Li, and B. S. Crabb. 2000. Internal ribosomal entry site-mediated translation initiation in equine rhinitis A virus: similarities to and differences from that of foot-and-mouth disease virus. J. Virol.74:11708-11716.
40.
Hofacker, I. L. 2003. Vienna RNA secondary structure server. Nucleic Acids Res.31:3429-3431.
41.
Hofmann, K., and W. Stoffel. 1993. TMBase, a database of membrane spanning protein segments. Biol. Chem. Hoppe-Seyler347:166.
42.
Hogle, J. M. 2002. Poliovirus cell entry: common structural themes in viral cell entry pathways. Annu. Rev. Microbiol.56:677-702.
43.
Huang, X., and A. Madan. 1999. CAP3: a DNA sequence assembly program. Genome Res.9:868-877.
44.
Huson, D. 1998. Splitstree: a program for analyzing and visualizing evolutionary data. Bioinformatics14:68-73.
45.
Jackson, T., A. M. Q. King, D. I. Stuart, and E. Fry. 2003. Structure and receptor binding. Virus Res.91:33-46.
46.
Jaeger, J. A., D. H. Turner, and M. Zuker. 1990. Predicting optimal and suboptimal secondary structure for RNA. Methods Enzymol.183:281-306.
47.
Jecht, M., C. Probst, and V. Gauss-Muller. 1998. Membrane permeability induced by hepatitis A virus proteins 2B and 2BC and proteolytic processing of HAV 2BC. Virology252:218-227.
48.
Jonassen, I. 1997. Efficient discovery of conserved patterns using a pattern graph. Comput. Appl. Biol. Sci.13:509-522.
49.
Jonassen, I., J. Collins, and D. Higgins. 1995. Finding flexible patterns in unaligned protein sequences. Protein Sci.4:1587-1595.
50.
Jones, D. T., W. R. Taylor, and J. M. Thornton. 1994. A model recognition approach to the prediction of all-helical membrane protein structure and topology. Biochemistry33:3038-3049.
51.
Kaku, Y., S. Yamada, and Y. Murakami. 1999. Sequence determination and phylogenetic analysis of RNA-dependent RNA polymerase (RdRp) of the porcine enterovirus 1 (PEV-1) Talfan strain. Arch. Virol.144:1845-1852.
52.
King, A. M. Q., D. McCahon, K. Saunders, J. W. I. Newman, and W. R. Slade. 1985. Multiple sites of recombination within the RNA genome of foot-and-mouth disease virus. Virus Res.3:373-384.
53.
Klein, M., H. J. Eggers, and B. Nelsen-Salz. 1999. Echovirus 9 strain barty non-structural protein 2C has NTPase activity. Virus Res.65:155-160.
54.
Knowles, N. J., P. R. Davies, T. Henry, L. V. O'Donnel, J. M. Pacheco, and P. W. Mason. 2001. Emergence in Asia of foot-and-mouth disease viruses with altered host range: characterization of alterations in the 3A protein. J. Virol.75:1551-1556.
55.
Knowles, N. J., and A. R. Samuel. 2003. Molecular epidemiology of foot-and-mouth disease virus. Virus Res.91:65-80.
56.
Koonin, E. V. 1991. The phylogeny of RNA-dependent RNA polymerases of positive-strand RNA viruses. J. Gen. Virol.72:2197-2206.
57.
Krebs, O., and O. Marquardt. 1992. Identification and characterization of foot-and-mouth disease virus O1 Burgwedel/1987 as an intertypic recombinant. J. Gen. Virol.73:613-619.
58.
Krogh, A., M. Brown, I. S. Mian, K. Sjolander, and D. Haussler. 1994. Hidden Markov models in computational biology: applications to protein modeling. J. Mol. Biol.235:1501-1531.
59.
Kronovetr, J., and T. Skern. 2002. Foot-and-mouth disease virus leader proteinase: a papain-like enzyme requiring an acidic environment in the active site. FEBS Lett.528:58-62.
60.
Kuhn, R., N. Luz, and E. Beck. 1990. Functional analysis of the internal translation initiation site of foot-and-mouth disease virus. J. Virol.64:4625-4631.
61.
Lama, J., M. A. Sanz, and L. Carrasco. 1998. Genetic analysis of poliovirus protein 3A: characterization of a non-cytopathic mutant virus defective in killing Vero cells. J. Gen. Virol.79:1911-1921.
62.
Logan, D., R. Abu-Ghazaleh, W. Blakemore, S. Curry, T. Jackson, A. King, S. Lea, R. Lewis, J. Newman, N. Parry, et al. 1993. Structure of a major immunogenic site on foot-and-mouth disease virus. Nature362:566-568.
63.
Lole, K. S., R. C. Bollinger, R. S. Paranjape, D. Gadkari, S. S. Kulkarni, N. G. Novak, R. Ingersoll, H. W. Sheppard, and S. C. Ray. 1999. Full-length human immunodeficiency virus type 1 genomes from subtype C-infected seroconverters in India, with evidence of intersubtype recombination. J. Virol.73:152-160.
64.
Lopez de Quinto, S., and E. Martinez-Salas. 1997. Conserved structural motifs located in distal loops of aphthovirus internal ribosome entry site domain 3 are required for internal initiation of translation. J. Virol.71:4171-4175.
65.
Lopez de Quinto, S., and E. Martinez-Salas. 2000. Interaction of the eIF4G initiation factor with the aphthovirus IRES is essential for internal translation initiation in vivo. RNA6:1380-1392.
66.
Lopez de Quinto, S., and E. Martinez-Salas. 1999. Involvement of the aphthovirus RNA region located between the two functional AUGs in start codon selection. Virology255:324-336.
67.
Lopez de Quinto, S., M. Saiz, D. de la Morena, F. Sobrino, and E. Martinez-Salas. 2002. IRES-driven translation is stimulated separately by the FMDV 3′-NCR and poly(A) sequences. Nucleic Acids Res.30:4398-4405.
68.
Mason, P. W., S. V. Bezborodova, and T. M. Henry. 2002. Identification and characterization of a cis-acting replication element (cre) adjacent to the internal ribosome entry site of foot-and-mouth disease virus. J. Virol.76:9686-9694.
69.
Mason, P. W., M. J. Grubman, and B. Baxt. 2003. Molecular basis of pathogenesis of FMDV. Virus Res.91:9-32.
70.
Mason, P. W., J. M. Pacheco, Q.-Z. Zhao, and N. J. Knowles. 2003. Comparisons of the complete genomes of Asian, African and European isolates of a recent foot-and-mouth disease virus type O pandemic strain (PanAsia). J. Gen. Virol.84:1583-1593.
71.
Mason, P. W., E. Rieder, and B. Baxt. 1994. RGD sequence of foot-and-mouth disease virus is essential for infecting cells via the natural receptor but can be bypassed by an antibody-dependent enhancement pathway. Proc. Natl. Acad. Sci. USA91:1932-1936.
72.
McKenna, T. S., J. Lubroth, E. Rieder, B. Baxt, and P. W. Mason. 1995. Receptor-binding site-deleted foot-and-mouth disease (FMD) virus protects cattle from FMD. J. Virol.69:5787-5790.
73.
Morgenstern, B. 1999. Dialign 2: improvement of the segment-to-segment approach to multiple sequence alignment. Bioinformatics15:211-218.
74.
Moscufo, N., J. Simons, and M. Chow. 1991. Myristoylation is important at multiple stages in poliovirus assembly. J. Virol.65:2372-2380.
75.
Murray, K. E., and D. J. Barton. 2003. Poliovirus CRE-dependent VPg uridylylation is required for positive-strand RNA synthesis but not for negative-strand RNA synthesis. J. Virol.77:4739-4750.
76.
Nakai, K., and P. Horton. 1999. PSORT: a program for detecting sorting signals in proteins and predicting their subcellular localization. Trends Biochem. Sci.24:34-35.
77.
Nei, M., and T. Gojobori. 1986. Simple methods for estimating the numbers of synonymous and non-synonymous nucleotide substitutions. Mol. Biol. Evol.3:418-426.
78.
Nunez, J. I., E. Baranowski, N. Molina, C. M. Ruiz-Jarabo, C. Sanchez, E. Domingo, and F. Sobrino. 2001. A single amino acid substitution in nonstructural protein 3A can mediate adaptation of foot-and-mouth disease virus to the guinea pig. J. Virol.75:3977-3983.
79.
Oberste, M. S., K. Maher, and M. A. Pallansch. 2004. Evidence for frequent recombination within species Human enterovirus B based on complete genomic sequences of all thirty-seven serotypes. J. Virol.78:855-867.
80.
O'Donnell, V. K., J. M. Pacheco, T. M. Henry, and P. W. Mason. 2001. Subcellular distribution of the foot-and-mouth disease virus 3A protein in cells infected with viruses encoding wild-type and bovine-attenuated forms of 3A. Virology287:151-162.
81.
Oem, J. K., K. N. Lee, I. S. Cho, S. J. Kye, J. H. Park, and Y. S. Joo. 2004. Comparison and analysis of the complete nucleotide sequence of foot-and-mouth disease viruses from animals in Korea and other PanAsia strains. Virus Genes29:63-71.
82.
Ohlmann, T., and R. J. Jackson. 1999. The properties of chimeric picornavirus IRESes show that discrimination between internal translation initiation sites is influenced by the identity of the IRES and not just the context of the AUG codon. RNA5:764-778.
83.
Osterburg, G., and R. Sommer. 1981. Computer support of DNA sequence analysis. Comput. Programs Biomed.13:101-109.
84.
Pacheco, J. M., T. M. Henry, V. K. O'Donnell, J. B. Gregory, and P. W. Mason. 2003. Role of nonstructural proteins 3A and 3B in host range and pathogenicity of foot-and-mouth disease virus. J. Virol.77:13017-13027.
85.
Paul, A. V., J. Yin, J. Mugavero, E. Rieder, Y. Liu, and E. Wimmer. 2003. A “slide back” mechanism for the initiation of protein-primed RNA synthesis by the RNA polymerase of poliovirus. J. Biol. Chem.278:43951-43960.
86.
Pereda, A. J., G. A. Konig, S. A. Chimeno Zoth, M. Borca, E. L. Palma, and M. E. Piccone. 2002. Full length nucleotide sequence of foot-and-mouth disease virus strain O1 Campos/Bra/58. Arch. Virol.147:2225-2230.
87.
Pereira, H. G. 1981. Foot and mouth disease. Academic Press Inc., London, United Kingdom.
88.
Perez Filgueira, M., A. Wigdorovitz, A. Romera, P. Zamorano, M. V. Borca, and A. M. Sadir. 2000. Detection and characterization of functional T-cell epitopes on the structural proteins VP2, VP3, and VP4 of foot and mouth disease virus O1 Campos. Virology271:234-239.
89.
Piccone, M. E., E. Rieder, P. W. Mason, and M. J. Grubman. 1995. The foot-and-mouth disease virus leader proteinase gene is not required for viral replication. J. Virol.69:5376-5382.
90.
Piccone, M. E., M. Zellner, T. F. Kumosinski, P. W. Mason, and M. J. Grubman. 1995. Identification of the active-site residues of the L proteinase of foot-and-mouth disease virus. J. Virol.69:4950-4956.
91.
Polatnick, J. 1980. Isolation of foot-and-mouth-disease polyuridylic acid polymerase and its inhibition by antibody. J. Virol.33:774-779.
92.
Polatnick, J., and S. H. Wool. 1983. Association of foot-and-mouth disease virus induced RNA polymerase with host cell organelles. Comp. Immunol. Microbiol. Infect. Dis.6:265-272.
93.
Porter, A. G. 1993. Picornavirus nonstructural proteins: emerging roles in virus replication and inhibition of host cell functions. J. Virol.67:6917-6921.
94.
Ramos, R., and E. Martinez-Salas. 1999. Long-range RNA interactions between structural domains of the aphthovirus internal ribosome entry site (IRES). RNA5:1374-1383.
95.
Rieder, E., T. Bunch, F. Brown, and P. W. Mason. 1993. Genetically engineered foot-and-mouth disease viruses with poly(C) tracts of two nucleotides are virulent in mice. J. Virol.67:5139-5145.
96.
Rivas, E., and S. R. Eddy. 1999. A dynamic programming algorithm for RNA structure prediction including pseudoknots. J. Mol. Biol.285:2053-2068.
97.
Rueckert, R. R. 1996. Picornaviridae: the viruses and their replication. Lippincott-Raven, Philadelphia, Pa.
98.
Saiz, M., S. Gomez, E. Martinez-Salas, and F. Sobrino. 2001. Deletion or substitution of the aphthovirus 3′ NCR abrogates infectivity and virus replication. J. Gen. Virol.82:93-101.
99.
Saleh, L., R. C. Rust, R. Fullkrug, E. Beck, G. Bassili, K. Ochs, and M. Niepmann. 2001. Functional interaction of translation initiation factor eIF4G with the foot-and-mouth disease virus internal ribosome entry site. J. Gen. Virol.82:757-763.
100.
Salminen, M. O., J. K. Carr, D. S. Burke, and F. E. McCutchan. 1995. Identification of breakpoints in intergenotypic recombinants of HIV type 1 by bootscanning. AIDS Res. Hum. Retrovir.11:1423-1425.
101.
Saunders, K., A. M. King, D. McCahon, J. W. I. Newman, W. R. Slade, and S. Forss. 1985. Recombination and oligonucleotide analysis of guanidine-resistant foot-and-mouth disease virus mutants. J. Virol.56:921-929.
102.
Sawyer, S. A. 1989. Statistical tests for detecting gene conversion. Mol. Biol. Evol.6:526-538.
103.
Schaefer, J., and M. Schoniger. 1997. DISTREE: a tool for estimating genetic distances between aligned DNA sequences. Comput. Appl. Biosci.13:445-451.
104.
Strimmer, K., and A. von Haeseler. 1996. Quartet puzzling: a quartet maximum-likelihood method for reconstructing tree topologies. Mol. Biol. Evol.13:964-969.
105.
Tamura, K., and M. Nei. 1993. Estimation of the number of nucleotide substitutions in the control region of mitochondrial DNA in humans and chimpanzees. Mol. Biol. Evol.10:512-526.
106.
Tesar, M., and O. Marquardt. 1989. Serological probes for some foot-and-mouth disease virus nonstructural proteins. Virus Genes3:29-44.
107.
Thompson, J. D., D. G. Higgins, and T. J. Gibson. 1994. CLUSTAL W: improving the sensitivity of progressive multiple sequence alignment through sequence weighting, position-specific gap penalties and weight matrix choice. Nucleic Acids Res.22:4673-4680.
108.
Toja, M., C. Escarmis, and E. Domingo. 1999. Genomic nucleotide sequence of a foot-and-mouth disease virus clone and its persistent derivatives. Implications for the evolution of viral quasispecies during a persistent infection. Virus Res.64:161-171.
109.
Tosh, C., D. Hemadri, and A. Sanyal. 2002. Evidence of recombination in the capsid-coding region of type A foot-and-mouth disease virus. J. Gen. Virol.83:2455-2460.
110.
Tosh, C., M. Mittal, A. Sanyal, D. Hemadri, and S. K. Bandyopadhyay. 2004. Molecular phylogeny of leader proteinase gene of type A of foot-and-mouth disease virus from India. Arch. Virol.149:523-536.
111.
Vakharia, V. N., M. A. Devaney, D. M. Moore, J. J. Dunn, and M. J. Grubman. 1987. Proteolytic processing of foot-and-mouth disease virus polyproteins expressed in a cell-free system from clone-derived transcripts. J. Virol.61:3199-3207.
112.
van Kuppeveld, F. J., J. G. Hoenderop, R. L. Smeets, P. H. Willems, H. B. Dijkman, J. M. Galama, and W. J. Melchers. 1997. Coxsackievirus protein 2B modifies endoplasmic reticulum membrane and plasma membrane permeability and facilitates virus release. EMBO J.16:3519-3532.
113.
van Rensburg, H., D. Haydon, F. Joubert, A. Bastos, L. Heath, and L. Nel. 2002. Genetic heterogeneity in the foot-and-mouth disease virus leader and 3C proteinases. Gene289:19-29.
114.
von Heijne, G. 1992. Membrane protein structure prediction: hydrophobicity analysis and the “positive inside” rule. J. Mol. Biol.225:487-494.
115.
Xiang, W., A. Cuconati, D. Hope, K. Kirkegaard, and E. Wimmer. 1998. Complete protein linkage map of poliovirus P3 proteins: interaction of polymerase 3Dpol with VPg and with genetic variants of 3AB. J. Virol.72:6732-6741.
116.
Yang, Z., R. Nielsen, N. Goldman, and A.-M. K. Pedersen. 2000. Codon-substitution models for heterogeneous selection pressure at amino acid sites. Genetics155:431-449.
117.
Zucker, M. 1989. Finding all suboptimal foldings of an RNA molecule. Science244:48-52.

Information & Contributors

Information

Published In

cover image Journal of Virology
Journal of Virology
Volume 79Number 1015 May 2005
Pages: 6487 - 6504
PubMed: 15858032

History

Received: 4 August 2004
Accepted: 18 January 2005
Published online: 15 May 2005

Permissions

Request permissions for this article.

Contributors

Authors

C. Carrillo
Plum Island Animal Disease Center, Agricultural Research Service, United States Department of Agriculture, Greenport, New York 11944
E. R. Tulman
Plum Island Animal Disease Center, Agricultural Research Service, United States Department of Agriculture, Greenport, New York 11944
Department of Pathobiology and Veterinary Science
Center of Excellence for Vaccine Research, University of Connecticut, Storrs, Connecticut 06269
G. Delhon
Plum Island Animal Disease Center, Agricultural Research Service, United States Department of Agriculture, Greenport, New York 11944
Area of Virology, School of Veterinary Sciences, University of Buenos Aires, 1427 Buenos Aires, Argentina
Z. Lu
Plum Island Animal Disease Center, Agricultural Research Service, United States Department of Agriculture, Greenport, New York 11944
A. Carreno
Plum Island Animal Disease Center, Agricultural Research Service, United States Department of Agriculture, Greenport, New York 11944
A. Vagnozzi
Plum Island Animal Disease Center, Agricultural Research Service, United States Department of Agriculture, Greenport, New York 11944
Department of Pathobiology and Veterinary Science
Center of Excellence for Vaccine Research, University of Connecticut, Storrs, Connecticut 06269
G. F. Kutish
Plum Island Animal Disease Center, Agricultural Research Service, United States Department of Agriculture, Greenport, New York 11944
Department of Pathobiology and Veterinary Science
Center of Excellence for Vaccine Research, University of Connecticut, Storrs, Connecticut 06269
Plum Island Animal Disease Center, Agricultural Research Service, United States Department of Agriculture, Greenport, New York 11944
Department of Pathobiology and Veterinary Science
Center of Excellence for Vaccine Research, University of Connecticut, Storrs, Connecticut 06269

Notes

Supplemental material for this article may be found at http://jvi.asm.org/ .

Metrics & Citations

Metrics

Note:

  • For recently published articles, the TOTAL download count will appear as zero until a new month starts.
  • There is a 3- to 4-day delay in article usage, so article usage will not appear immediately after publication.
  • Citation counts come from the Crossref Cited by service.

Citations

If you have the appropriate software installed, you can download article citation data to the citation manager of your choice. For an editable text file, please select Medlars format which will download as a .txt file. Simply select your manager software from the list below and click Download.

View Options

Figures and Media

Figures

Media

Tables

Share

Share

Share the article link

Share with email

Email a colleague

Share on social media

American Society for Microbiology ("ASM") is committed to maintaining your confidence and trust with respect to the information we collect from you on websites owned and operated by ASM ("ASM Web Sites") and other sources. This Privacy Policy sets forth the information we collect about you, how we use this information and the choices you have about how we use such information.
FIND OUT MORE about the privacy policy